Ent AS-48(84) Protein Card

General Information
Name Ent AS-48
Sequence MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGL
SLLAAAGRESIKAYLKKEIKKKGKRAVIAW
Class Bacterial
Average Mass 7149.54
Monoisotopic Mass 7145.07
m/z M+H 7146.08
ProteinType Wild type
Parent
Organism Enterococcus faecalis
Notes Cyclic bacteriocin
Cyclic Yes

Assay
Anti-bacterial
Peptide antibiotic AS-48 exerts a bactericidal mode of action on exponential cultures of Escherichia coli K-12 through a multi-hit kinetics interaction. [...]Galvez A et al. (1989) Can J Microbiol 35:318-21

References
Galvez A, Valdivia E, Maqueda M, Montoya E (1985) Production of bacteriocin-like substances by group D streptococci of human origin. Microbios 43:223-32
Gonzalez C, Langdon GM, Bruix M, Galvez A, Valdivia E, Maqueda M, Rico M (2000) Bacteriocin AS-48, a microbial cyclic polypeptide structurally and functionally related to mammalian NK-lysin. Proc Natl Acad Sci U S A 97:11221-6
Sanchez-Barrena MJ, Martinez-Ripoll M, Galvez A, Valdivia E, Maqueda M, Cruz V, Albert A (2003) Structure of bacteriocin AS-48: from soluble state to membrane bound state. J Mol Biol 334:541-9
Samyn B, Martinez-Bueno M, Devreese B, Maqueda M, Galvez A, Valdivia E, Coyette J, Van Beeumen J (1994) The cyclic structure of the enterococcal peptide antibiotic AS-48. FEBS Lett 352:87-90
Galvez A, Valdivia E, Martinez M, Maqueda M (1989) Bactericidal action of peptide antibiotic AS-48 against Escherichia coli K-12. Can J Microbiol 35:318-21
Martinez-Bueno M, Maqueda M, Galvez A, Samyn B, Van Beeumen J, Coyette J, Valdivia E (1994) Determination of the gene sequence and the molecular structure of the enterococcal peptide antibiotic AS-48. J Bacteriol 176:6334-9
Langdon GM, Bruix M, Galvez A, Valdivia E, Maqueda M, Rico M (1998) Sequence-specific 1H assignment and secondary structure of the bacteriocin AS-48 cyclic peptide. J Biomol NMR 12:173-5

Cross-references
Nucleic acids E.faecalis plasmid AS48 gene
Structure Ent AS-48
Ent AS-48
Ent AS-48
Ent AS-48
Links GenBank CAA72917
SwissProt Q47765

Tools