MTAbl14(1622) Protein Card

General Information
Name MTAbl14
Sequence GGVCEAIYAAPKCRRDSDCPGACICRGNGYCGEAIYAAPF
AR
Class Squash trypsin inhibitor
Average Mass 4332.91
Monoisotopic Mass 4329.88
m/z M+H 4332.91
ProteinType Grafted
Parent MCoTI-II
Organism Synthetic
Notes Tyr-8 and Tyr-36 are phosphorylated.
Cyclic Yes

Assay
No assays found

References
Huang,Y.H., Henriques,S.T., Wang,C.K., Thorstholm,L., Daly,N.L., Kaas,Q. and Craik,D.J. (2015) Design of substrate-based BCR-ABL kinase inhibitors using the cyclotide scaffold. Sci Rep 5:12974-0

Cross-references
Nucleic acids
Structure
Links

Tools